Anti-DcR1 antibody GTX21674 from GeneTex

Description

GeneTex's Anti-DcR1 antibody is a Goat Polyclonal antibody. The Anti-DcR1 antibody was generated using CD263, DCR1, DCR1TNFR, LIT, TNF receptor superfamily member 10c, TNFRSF10C, TRAILR3, TRID, DcR1, TRAIL-R3 as the antigen. The Anti-DcR1 antibody from GeneTex is a Goat Polyclonal antibody to DcR1. The Anti-DcR1 antibody Recognizes Human, Mouse, Chimpanzee. The Anti-DcR1 antibody has been validated for the following Applications: WB, FACS, ELISA, IHC

Product Specs
ItemAnti-DcR1 antibody
CompanyGeneTex
Price Pricing Info Supplier Page
Catalog NumberGTX21674
Conjugate/TagUnconjugated
ClonalityPolyclonal
HostGoat
IsotypeIgG
Quantity100 µg
ApplicationsWB, FACS, ELISA, IHC
Antibody TypePrimary Antibodies
TargetDcR1
ReactivityHuman, Mouse, Chimpanzee
Format10mM KHPO₄, 140mM NaCl, 0.1% BSA, 0.1% Sodium azide
ImmunogenSynthetic peptide EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC aa 33-63, corresponding to the extracellular domain sequence of human TRAIL-R3 (DcR1)
Concentration1mg/ml
NCBI Full Gene NameTNF receptor superfamily member 10c
NCBI Gene AliasesDCR1, TRID, CD263, DCR1, DCR1TNFR, LIT, TNF receptor superfamily member 10c, TNFRSF10C, TRAILR3, TRID, DcR1, TRAIL-R3, CD263, LIT, DCR1-TNFR, TRAIL-R3, TRAILR3
PurityPurified by affinity chromatography
Research AreaCell Biology
Gene NameTNFRSF10C
Molecular Weight27